PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA03g28010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 323aa    MW: 37089 Da    PI: 4.7842
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA03g28010genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.71.1e-1983136356
                 --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 k++++t++q++ Le++F +++++  e++ +LAk+lgL+ rq+ +WFqNrRa++k
  CA03g28010  83 KKRRLTDNQVQFLEKCFGEENKLEPERKVQLAKELGLQPRQIAIWFQNRRARWK 136
                 56689************************************************9 PP

2HD-ZIP_I/II126.11.6e-4082172191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  ekkrrl+++qv++LE++F ee+kLeperKv+la+eLglqprq+a+WFqnrRAR+ktkqlEk+ye L+++yd lk++ ++L ke+e+Lr e+
   CA03g28010  82 EKKRRLTDNQVQFLEKCFGEENKLEPERKVQLAKELGLQPRQIAIWFQNRRARWKTKQLEKEYEELRNRYDDLKSNYNTLLKEKENLRVEV 172
                  69*************************************************************************************9877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.41E-1973140IPR009057Homeodomain-like
PROSITE profilePS5007117.28178138IPR001356Homeobox domain
SMARTSM003896.1E-1981142IPR001356Homeobox domain
CDDcd000864.10E-1783139No hitNo description
Gene3DG3DSA:1.10.10.601.3E-1983136IPR009057Homeodomain-like
PfamPF000464.8E-1783136IPR001356Homeobox domain
PRINTSPR000316.2E-6109118IPR000047Helix-turn-helix motif
PROSITE patternPS000270113136IPR017970Homeobox, conserved site
PRINTSPR000316.2E-6118134IPR000047Helix-turn-helix motif
PfamPF021831.2E-11138179IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MMARGMLYGG GSNFDQKQRD MYFSTAKEHL GSLFGPDCSS FFGSSSMVSF RGVNGGKRSF  60
FDSFDQEDNE ADELGEYFHQ AEKKRRLTDN QVQFLEKCFG EENKLEPERK VQLAKELGLQ  120
PRQIAIWFQN RRARWKTKQL EKEYEELRNR YDDLKSNYNT LLKEKENLRV EVFQLTDKLL  180
VKEKGNGQLT LCDIQKQSNA SVEVTVADPI SRVELSNVPS RILKQQKQED LSSAKSDVFD  240
SESPHYTDKR HSTFIDQGDS ARVFETEQSD LSQDDDENFG KAMLSTANLL GKVEDDDYPA  300
TSSNMHYFGF PSDDQGFGFW TY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130138RRARWKTKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754421e-137HG975442.1 Solanum pennellii chromosome ch03, complete genome.
GenBankHG9755151e-137HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
GenBankX949471e-137X94947.1 L.esculentum mRNA for homeobox protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016563582.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like
TrEMBLM1CDJ80.0M1CDJ8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000652070.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.13e-40homeobox 1